HLA-A*11:104

Back to allele selection.

Motif

HLA-A*11:104 motif
Motifs for HLA-A*11:104

Length distribution

HLA-A*11:104 length distribution
Length distributions for HLA-A*11:104

Extracted MHC positions (pseudosequence)

YYAMYQENVAQTDVDTLYGIIYDRDYTWAAQAYRWYX

Alleles with identical predictions

HLA-A*11:104 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*11:105
  • HLA-A*11:114
  • HLA-A*11:117
  • HLA-A*11:119
  • HLA-A*11:123
  • HLA-A*11:131
  • HLA-A*11:132
  • HLA-A*11:135
  • HLA-A*11:136
  • HLA-A*11:138
  • HLA-A*11:145
  • HLA-A*11:147
  • HLA-A*11:148
  • HLA-A*11:15
  • HLA-A*11:150
  • HLA-A*11:16
  • HLA-A*11:165
  • HLA-A*11:166
  • HLA-A*11:167
  • HLA-A*11:181
  • HLA-A*11:184
  • HLA-A*11:185
  • HLA-A*11:186
  • HLA-A*11:187
  • HLA-A*11:189
  • HLA-A*11:196
  • HLA-A*11:197
  • HLA-A*11:198
  • HLA-A*11:200
  • HLA-A*11:201
  • HLA-A*11:202
  • HLA-A*11:205
  • HLA-A*11:207
  • HLA-A*11:212
  • HLA-A*11:213
  • HLA-A*11:214
  • HLA-A*11:219
  • HLA-A*11:225
  • HLA-A*11:227
  • HLA-A*11:228
  • HLA-A*11:23
  • HLA-A*11:231
  • HLA-A*11:233
  • HLA-A*11:234
  • HLA-A*11:236
  • HLA-A*11:237
  • HLA-A*11:239
  • HLA-A*11:240
  • HLA-A*11:243
  • HLA-A*11:244
  • HLA-A*11:245
  • HLA-A*11:258
  • HLA-A*11:260
  • HLA-A*11:267
  • HLA-A*11:268
  • HLA-A*11:281
  • HLA-A*11:294
  • HLA-A*11:297
  • HLA-A*11:298
  • HLA-A*11:299
  • HLA-A*11:30
  • HLA-A*11:302
  • HLA-A*11:32
  • HLA-A*11:34
  • HLA-A*11:37
  • HLA-A*11:42
  • HLA-A*11:46
  • HLA-A*11:51
  • HLA-A*11:54
  • HLA-A*11:58
  • HLA-A*11:63
  • HLA-A*11:65
  • HLA-A*11:66
  • HLA-A*11:67
  • HLA-A*11:68
  • HLA-A*11:71
  • HLA-A*11:72
  • HLA-A*11:73
  • HLA-A*11:79
  • HLA-A*11:80
  • HLA-A*11:81
  • HLA-A*11:82
  • HLA-A*11:83
  • HLA-A*11:84
  • HLA-A*11:85
  • HLA-A*11:89
  • HLA-A*11:91
  • HLA-A*11:92
  • HLA-A*11:97