HLA-A*02:172

Back to allele selection.

Motif

HLA-A*02:172 motif
Motifs for HLA-A*02:172

Length distribution

HLA-A*02:172 length distribution
Length distributions for HLA-A*02:172

Extracted MHC positions (pseudosequence)

YYAMYGEKVAHTHVDTLYGLRYDHYYTWAVWAYTWYX

Alleles with identical predictions

HLA-A*02:172 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*02:232
  • HLA-A*02:286
  • HLA-A*02:337
  • HLA-A*02:359
  • HLA-A*02:413
  • HLA-A*02:421
  • HLA-A*02:433
  • HLA-A*02:484
  • HLA-A*02:495
  • HLA-A*02:496
  • HLA-A*02:507
  • HLA-A*02:532
  • HLA-A*02:546
  • HLA-A*02:591
  • HLA-A*02:593
  • HLA-A*02:626
  • HLA-A*02:631