HLA-A*02:07

Back to allele selection.

Motif

HLA-A*02:07 motif
Motifs for HLA-A*02:07

Length distribution

HLA-A*02:07 length distribution
Length distributions for HLA-A*02:07

Extracted MHC positions (pseudosequence)

YFAMYGEKVAHTHVDTLYGVRCDHYYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*02:07 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*02:18
  • HLA-A*02:265
  • HLA-A*02:335
  • HLA-A*02:426
  • HLA-A*02:449
  • HLA-A*02:450
  • HLA-A*02:451
  • HLA-A*02:452
  • HLA-A*02:477
  • HLA-A*02:478
  • HLA-A*02:721
  • HLA-A*02:764
  • HLA-A*02:771
  • HLA-A*02:822
  • HLA-A*02:859