HLA-A*02:06
Back to allele selection.
Motif
Length distribution
Extracted MHC positions (pseudosequence)
YYAMYGEKVAHTHVDTLYGVRYDHYYTWAVLAYTWYA
Alleles with identical predictions
HLA-A*02:06 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.
- HLA-A*02:126
- HLA-A*02:137
- HLA-A*02:144
- HLA-A*02:170
- HLA-A*02:21
- HLA-A*02:248
- HLA-A*02:259
- HLA-A*02:28
- HLA-A*02:295
- HLA-A*02:328
- HLA-A*02:330
- HLA-A*02:333
- HLA-A*02:405
- HLA-A*02:409
- HLA-A*02:428
- HLA-A*02:438
- HLA-A*02:465
- HLA-A*02:470
- HLA-A*02:472
- HLA-A*02:473
- HLA-A*02:475
- HLA-A*02:493
- HLA-A*02:51
- HLA-A*02:549
- HLA-A*02:558
- HLA-A*02:602
- HLA-A*02:61
- HLA-A*02:623
- HLA-A*02:625
- HLA-A*02:697
- HLA-A*02:718
- HLA-A*02:72
- HLA-A*02:725
- HLA-A*02:727
- HLA-A*02:737
- HLA-A*02:759
- HLA-A*02:767
- HLA-A*02:768
- HLA-A*02:79
- HLA-A*02:800
- HLA-A*02:801
- HLA-A*02:813
- HLA-A*02:837
- HLA-A*02:851
- HLA-A*02:863
- HLA-A*02:877
- HLA-A*02:878
- HLA-A*02:888
- HLA-A*02:898