HLA-A*02:06

Back to allele selection.

Motif

HLA-A*02:06 motif
Motifs for HLA-A*02:06

Length distribution

HLA-A*02:06 length distribution
Length distributions for HLA-A*02:06

Extracted MHC positions (pseudosequence)

YYAMYGEKVAHTHVDTLYGVRYDHYYTWAVLAYTWYA

Alleles with identical predictions

HLA-A*02:06 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*02:126
  • HLA-A*02:137
  • HLA-A*02:144
  • HLA-A*02:170
  • HLA-A*02:21
  • HLA-A*02:248
  • HLA-A*02:259
  • HLA-A*02:28
  • HLA-A*02:295
  • HLA-A*02:328
  • HLA-A*02:330
  • HLA-A*02:333
  • HLA-A*02:405
  • HLA-A*02:409
  • HLA-A*02:428
  • HLA-A*02:438
  • HLA-A*02:465
  • HLA-A*02:470
  • HLA-A*02:472
  • HLA-A*02:473
  • HLA-A*02:475
  • HLA-A*02:493
  • HLA-A*02:51
  • HLA-A*02:549
  • HLA-A*02:558
  • HLA-A*02:602
  • HLA-A*02:61
  • HLA-A*02:623
  • HLA-A*02:625
  • HLA-A*02:697
  • HLA-A*02:718
  • HLA-A*02:72
  • HLA-A*02:725
  • HLA-A*02:727
  • HLA-A*02:737
  • HLA-A*02:759
  • HLA-A*02:767
  • HLA-A*02:768
  • HLA-A*02:79
  • HLA-A*02:800
  • HLA-A*02:801
  • HLA-A*02:813
  • HLA-A*02:837
  • HLA-A*02:851
  • HLA-A*02:863
  • HLA-A*02:877
  • HLA-A*02:878
  • HLA-A*02:888
  • HLA-A*02:898