HLA-A*02:03

Back to allele selection.

Motif

HLA-A*02:03 motif
Motifs for HLA-A*02:03

Length distribution

HLA-A*02:03 length distribution
Length distributions for HLA-A*02:03

Extracted MHC positions (pseudosequence)

YFAMYGEKVAHTHVDTLYGVRYDHYYTWAEWAYTWYA

Alleles with identical predictions

HLA-A*02:03 has identical extracted MHC positions (pseudosequence) as the following others. Predictions for these alleles are the same.

  • HLA-A*02:230
  • HLA-A*02:253
  • HLA-A*02:264
  • HLA-A*02:315
  • HLA-A*02:370
  • HLA-A*02:427
  • HLA-A*02:431
  • HLA-A*02:463
  • HLA-A*02:480
  • HLA-A*02:505
  • HLA-A*02:557
  • HLA-A*02:684
  • HLA-A*02:711
  • HLA-A*02:774
  • HLA-A*02:850
  • HLA-A*02:860